PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3262_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 262aa    MW: 29282.5 Da    PI: 5.1778
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3262_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.8e-1995155257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 r+R+t+t+ ql++Le+ F +   +ps++++++++++l    ++ e++V++WFqNrRa+ k+
  RrC3262_p3  95 RQRWTPTPLQLQTLERIFDQgIGTPSKQKIKDITEELsqhgQIAEQNVYNWFQNRRARSKR 155
                 89*****************99**************************************97 PP

2Wus_type_Homeobox99.72.2e-3295157365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        r+RWtPtp Q++ Le+++++G+ tP+k++i++it+eL+++G+i ++NV++WFQNr+aR+++kq
         RrC3262_p3  95 RQRWTPTPLQLQTLERIFDQGIGTPSKQKIKDITEELSQHGQIAEQNVYNWFQNRRARSKRKQ 157
                        79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.31791156IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-1591158IPR009057Homeodomain-like
SMARTSM003891.5E-1293160IPR001356Homeobox domain
SuperFamilySSF466896.42E-1693157IPR009057Homeodomain-like
PfamPF000462.6E-1795155IPR001356Homeobox domain
CDDcd000866.58E-1295157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MMDWDNNQQQ PNNNHNSSNL QGIDVNGGSS SGGMYVKVMT DEQLETLRKQ IAIYATICER  60
LVEMHKTLTS QQDLAGGRMG VLYADPTFGH KMAGRQRWTP TPLQLQTLER IFDQGIGTPS  120
KQKIKDITEE LSQHGQIAEQ NVYNWFQNRR ARSKRKQHGG GGGSSNNNNG ESEVETEIEK  180
VNEKRKMPES LLVLPDGNNN NGIGTTIATS PRPEDLCFQS PEMSSDLHLL GVLSNPRDED  240
LVGKMGLSES YNLYDHVEDY GM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148156RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013643268.11e-154PREDICTED: WUSCHEL-related homeobox 13
SwissprotO817881e-140WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A078HV111e-153A0A078HV11_BRANA; BnaA03g53400D protein
STRINGBra017720.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46202851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-125WUSCHEL related homeobox 13